PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 210aa    MW: 22300.8 Da    PI: 6.7388
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30438genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.62.6e-16126159134
   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
            C +Cg+ ++p+WRrgp  +++LCnaCG +yr+++
  30438 126 CDHCGALDSPQWRRGPASKPMLCNACGTRYRRTN 159
            9***************99999**********875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.5E-7120174IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.295120175IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-11121165IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.81E-11122163No hitNo description
CDDcd002025.46E-11125164No hitNo description
PfamPF003208.5E-14126158IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MLGEETPSAR ELVPDRRWYT LVKIHDDGCT VAVSDAELAM LEASILKENV GGGANAWTRP  60
SSMRPCSSEE DGSGGRWAPD DAEEYEECGA SGRGGDSMSA WEDSEVSRLP SAAPGVAGHT  120
KPGGPCDHCG ALDSPQWRRG PASKPMLCNA CGTRYRRTNN LGPSPSSRMA TPEKRKATAV  180
QQNDTPRGKK NARCGAIGEK FSRANAMVY*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005830.0CP000583.1 Ostreococcus lucimarinus CCE9901 chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001416579.11e-152predicted protein
TrEMBLA4RTZ21e-152A4RTZ2_
STRINGA4RTZ21e-152(Ostreococcus lucimarinus CCE9901)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.14e-11GATA transcription factor 26